PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009771503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 492aa    MW: 53649.8 Da    PI: 6.4256
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009771503.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-39148208262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_009771503.1 148 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSV 208
                     7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30145205IPR003851Zinc finger, Dof-type
PfamPF027013.0E-32150206IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.919152206IPR003851Zinc finger, Dof-type
PROSITE patternPS013610154190IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MRQVKDPEIK LFGKKIALPE NGKILSVIVS GEDSGVEKTS GAKEISSGWD RDPCLVDKEA  60
SSPDESDDGS EYENEKTDKD QVTRELTEDI SEEKDQDQVM KESENPKSPS ESENKPKTPP  120
IDDESPTVKS FKTENDATDS QQKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK  180
SCQRYWTAGG TMRNVPVGAG RRKNKNSVSH CHHVMISEAL QAARIDPSNG FHHPTLKPNG  240
TVLSFGPDLP LCDSMASVIN LAEKKTPNGI RNGYYKPEHK NSSCLGGENG DDCSSGSSVT  300
TNSMAGVKNR PPEAVMQTMN GFPSPVPCLP GVPWPFPYAA APFPSMNPAV FPIPFCPPPY  360
WNCNIPGPWS IPWLASPSPT ANQNGSGSAP NSPLGKHSRD GDLLRPNNPE GQKNSEGSVL  420
VPKTLRIDDP DEAAKSSIWS TLGINYDSVS RGGLFKGFQP KSSEKDHPAT TSPVLQANPV  480
AFSRSLSFQE RA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771503.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLM1BQ210.0M1BQ21_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-92cycling DOF factor 3